PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0036s0350.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MYB
Protein Properties Length: 226aa    MW: 25273 Da    PI: 6.9625
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0036s0350.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.63.2e-092365344
                            SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
         Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                            rWT eEd+++ +a + ++ +   +W +Ia+++   +++ ++k+++
  SapurV1A.0036s0350.1.p 23 RWTREEDKIFEQALTVFPENlpdRWQSIANHIR--KSAWEVKEHY 65
                            9*******************************8..8********9 PP

2Myb_DNA-binding43.29.1e-14131175347
                             SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
         Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                             +WT++E++l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
  SapurV1A.0036s0350.1.p 131 PWTEDEHKLFLVGLSKFGKGDWRSISRNVVITRTPTQVASHAQKY 175
                             8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.761669IPR017877Myb-like domain
SMARTSM007179.0E-82071IPR001005SANT/Myb domain
CDDcd001671.69E-72365No hitNo description
PfamPF002495.9E-62365IPR001005SANT/Myb domain
SuperFamilySSF466891.45E-122377IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-42368IPR009057Homeodomain-like
PROSITE profilePS5129418.415124180IPR017930Myb domain
SuperFamilySSF466891.31E-16125181IPR009057Homeodomain-like
TIGRFAMsTIGR015577.6E-17127179IPR006447Myb domain, plants
SMARTSM007173.2E-11128178IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-10128174IPR009057Homeodomain-like
CDDcd001672.46E-9131176No hitNo description
PfamPF002491.4E-12131175IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MHQDFNFQTR CLTQPPHDAA SARWTREEDK IFEQALTVFP ENLPDRWQSI ANHIRKSAWE  60
VKEHYDVLVH DVFAIDSGRV ELPTYRDDDS VRWESGGAGG GMVAADAQPS GQICFGGGKA  120
KQDTERKKGT PWTEDEHKLF LVGLSKFGKG DWRSISRNVV ITRTPTQVAS HAQKYFLRQN  180
SVKKERKRSS IHDITSVDNN TVGPSADDYW NSPSVPPTNP DGPPG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-1324861174RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316492.21e-150hypothetical protein POPTR_0010s24710g
SwissprotQ8S9H72e-54DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLB9HVV51e-150B9HVV5_POPTR; Uncharacterized protein
STRINGPOPTR_0010s24710.11e-149(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.14e-79MYB family protein